PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK02698.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family SRS
Protein Properties Length: 329aa    MW: 33653.8 Da    PI: 8.4973
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK02698.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702214.91.9e-661122733154
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelet 102
                s ta+CqdCGnqakkdC+h+RCRtCCksrgfdC+thvkstWvpaa+rrerq +++a     +   ++ ++   ++ +  +++++s+t++s+++++++++t
  PK02698.1 112 SSTATCQDCGNQAKKDCTHRRCRTCCKSRGFDCSTHVKSTWVPAARRRERQLMTSAGPGGGTGPGSSGSTSGAKKPRLIASQTTSHTSTSNTTPPRSFDT 211
                67899*********************************************9988887666555444444444444445577888999999********99 PP

     DUF702 103 ss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                ss          lP +v+++avf+cvrv++v+dge+e+aYq++v+igGhvfkG+LydqG+e+
  PK02698.1 212 SSshqdasfketLPGQVRAPAVFKCVRVTAVEDGEDEYAYQAVVKIGGHVFKGFLYDQGVET 273
                9999*******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.6E-62114272IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.2E-27116158IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.1E-30224271IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
XATALGVGVG VGVIPLLTAA PCLGPSHLDE ATEANALGSS SAAARSRNGG IQLWQSQAQQ  60
AAAVSAAQTQ LHPHFFKKPS IHDHGNSEIG GNLVIQSGGG GGINVGSGST SSSTATCQDC  120
GNQAKKDCTH RRCRTCCKSR GFDCSTHVKS TWVPAARRRE RQLMTSAGPG GGTGPGSSGS  180
TSGAKKPRLI ASQTTSHTST SNTTPPRSFD TSSSHQDASF KETLPGQVRA PAVFKCVRVT  240
AVEDGEDEYA YQAVVKIGGH VFKGFLYDQG VETTTRDNST FPNLSELHLG GGGGRNGASS  300
SSPMLDPSDV YAASTAGLLG GSTYGNPIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012435560.11e-116PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
TrEMBLA0A0B0MGZ41e-119A0A0B0MGZ4_G
STRINGVIT_06s0009g03450.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-68Lateral root primordium (LRP) protein-related